All suppliers fitzgerald Rat IL23 ELISA kit

Information

Catalog number
55R-2167
Name
Rat IL23 ELISA kit
Supplier
Size
96 tests
Price
840.00

Details

Category
Research kit
Area of research
Cytokines & Growth Factors
Specificity
Rat IL23
Residues
GKFMKPGKVVLVLAGRYSGALKRKARREAKVKFEERYKTGKNKWFFQKLRFRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKSF VKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDP
Storage
Store unopened kit at 2-8 deg C, do not use past expiration date
Tested for
ELISA
Assay Information
Detection Range: 3.12 pg/ml-200 pg/ml; Sensitivity: 0.78 pg/ml; Compatible Sample Types: serum, plasmaļ¼Œcell culture supernates, tissue homogenates; Assay Time: 1-5 hours; Sample Volume: 50-100 ul; Detection Wavelength: 450 nm
Properties
E05 478 566 350 170 or Enzyme-Linked Immunosorbent Assays,E05 478 566 350 170 or Enzyme-Linked Immunosorbent Assays
Test
ELISA Enzyme-linked immunosorbent assays Code 90320007 SNOMED
About
Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
Latin name
Rattus norvegicus